SCOPe 2.06: Domain d3otza_: 3otz A:

Lineage for d3otza_ (3otz A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.5: gamma-carbonic anhydrase-like [51174] (4 proteins)
   archaeal hexapeptide repeat proteins
   this is a repeat family; one repeat unit is 1v3w A:71-88 found in domain

6. Protein gamma-carbonic anhydrase [51175] (1 species)

7. Species Methanosarcina thermophila [TaxId:2210] [51176] (12 PDB entries)

8. Domain d3otza_: 3otz A: [183284]
   automated match to d1qrla_
   complexed with zn; mutant

Details for d3otza_

PDB Entry: 3otz, 1.6 Å

PDB Description: crystal structure of gamma-carbonic anhydrase w19a mutant from metanosarcina thermophila

PDB Compounds: (A:) carbonic anhydrase

SCOPe Domain Sequences for d3otza_:

Sequence; same for both SEQRES and ATOM records:

>d3otza_ b.81.1.5 (A:) gamma-carbonic anhydrase {Methanosarcina thermophila [TaxId: 2210]}
snirenpvtpanpepsapvidptayidpqasvigevtiganvmvspmasirsdegmpifv
gdrsnvqdgvvlhaletineegepiednivevdgkeyavyignnvslahqsqvhgpaavg
ddtfigmqafvfkskvgnncvleprsaaigvtipdgryipagmvvtsqaeadklpevtdd
yayshtneavvyvnvhlaegykets

Timeline for d3otza_:

• d3otza_ first appeared in SCOPe 2.01
  
• d3otza_ appears in SCOPe 2.05
  
• d3otza_ appears in SCOPe 2.07
  
• d3otza_ appears in the current release, SCOPe 2.08