SCOPe 2.01: Domain d3otfa_: 3otf A:

Lineage for d3otfa_ (3otf A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein automated matches [190352] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189505] (3 PDB entries)

8. Domain d3otfa_: 3otf A: [183280]
   automated match to d1q5oa_
   complexed with cmp

Details for d3otfa_

PDB Entry: 3otf, 2.4 Å

PDB Description: structural basis for the camp-dependent gating in human hcn4 channel

PDB Compounds: (A:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4

SCOPe Domain Sequences for d3otfa_:

Sequence; same for both SEQRES and ATOM records:

>d3otfa_ b.82.3.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dssrrqyqekykqveqymsfhklppdtrqrihdyyehryqgkmfdeesilgelseplree
iinfncrklvasmplfanadpnfvtsmltklrfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnketkladgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetvaldrldrigkk

Timeline for d3otfa_:

• d3otfa_ is new in SCOPe 2.01-stable
  
• d3otfa_ appears in SCOPe 2.02
  
• d3otfa_ appears in the current release, SCOPe 2.08