Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
Protein automated matches [190197] (6 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [189482] (1 PDB entry) |
Domain d3ot1a_: 3ot1 A: [183276] automated match to d2ab0a1 complexed with cl, na |
PDB Entry: 3ot1 (more details), 1.16 Å
SCOPe Domain Sequences for d3ot1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ot1a_ c.23.16.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]} skrilvpvahgseemetviivdtlvragfqvtmaavgdklqvqgsrgvwltaeqtleacs aeafdalalpggvggaqafadstallalidafsqqgklvaaicatpalvfakqqkfvgar mtchpnffdhipserlsrqrvcyyatqhlltsqgpgtalefalamiallagvelaqhvaa pmvlhpqqltelsgfidaq
Timeline for d3ot1a_: