SCOPe 2.01: Domain d3ot1a_: 3ot1 A:

Lineage for d3ot1a_ (3ot1 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (6 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [189482] (1 PDB entry)

8. Domain d3ot1a_: 3ot1 A: [183276]
   automated match to d2ab0a1
   complexed with cl, na

Details for d3ot1a_

PDB Entry: 3ot1, 1.16 Å

PDB Description: crystal structure of vc2308 protein

PDB Compounds: (A:) 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme

SCOPe Domain Sequences for d3ot1a_:

Sequence; same for both SEQRES and ATOM records:

>d3ot1a_ c.23.16.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
skrilvpvahgseemetviivdtlvragfqvtmaavgdklqvqgsrgvwltaeqtleacs
aeafdalalpggvggaqafadstallalidafsqqgklvaaicatpalvfakqqkfvgar
mtchpnffdhipserlsrqrvcyyatqhlltsqgpgtalefalamiallagvelaqhvaa
pmvlhpqqltelsgfidaq

Timeline for d3ot1a_:

• d3ot1a_ is new in SCOPe 2.01-stable
  
• d3ot1a_ appears in SCOPe 2.02
  
• d3ot1a_ appears in the current release, SCOPe 2.08