Lineage for d3osxa_ (3osx A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1155496Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 1155656Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 1155657Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)
  6. 1155824Protein automated matches [191245] (1 species)
    not a true protein
  7. 1155825Species Xenorhabdus nematophila [TaxId:628] [189729] (1 PDB entry)
  8. 1155826Domain d3osxa_: 3osx A: [183274]
    automated match to d1kida_

Details for d3osxa_

PDB Entry: 3osx (more details), 1.55 Å

PDB Description: Crystal Structure of Apical Domain of Insecticidal GroEL from Xenorhapdus nematophila
PDB Compounds: (A:) 60 kda chaperonin

SCOPe Domain Sequences for d3osxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3osxa_ c.8.5.1 (A:) automated matches {Xenorhabdus nematophila [TaxId: 628]}
segmqfdrgylspyfinkpesgsvelenpyillvdkkisnirellpvlegvakaskplvi
iaedvegealatlvvnnmrgivkvasvkapgfgdrrkamlqdiatltngtviseeiglel
ekatledlgqakrvvinkdtttiidgvgeegaiaarvtqirqqieestsdydreklqerv
aklaggvkln

SCOPe Domain Coordinates for d3osxa_:

Click to download the PDB-style file with coordinates for d3osxa_.
(The format of our PDB-style files is described here.)

Timeline for d3osxa_: