SCOPe 2.02: Domain d3osxa_: 3osx A:

Lineage for d3osxa_ (3osx A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (2 families)

5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)

6. Protein automated matches [191245] (1 species)
   not a true protein

7. Species Xenorhabdus nematophila [TaxId:628] [189729] (1 PDB entry)

8. Domain d3osxa_: 3osx A: [183274]
   automated match to d1kida_

Details for d3osxa_

PDB Entry: 3osx, 1.55 Å

PDB Description: Crystal Structure of Apical Domain of Insecticidal GroEL from Xenorhapdus nematophila

PDB Compounds: (A:) 60 kda chaperonin

SCOPe Domain Sequences for d3osxa_:

Sequence; same for both SEQRES and ATOM records:

>d3osxa_ c.8.5.1 (A:) automated matches {Xenorhabdus nematophila [TaxId: 628]}
segmqfdrgylspyfinkpesgsvelenpyillvdkkisnirellpvlegvakaskplvi
iaedvegealatlvvnnmrgivkvasvkapgfgdrrkamlqdiatltngtviseeiglel
ekatledlgqakrvvinkdtttiidgvgeegaiaarvtqirqqieestsdydreklqerv
aklaggvkln

Timeline for d3osxa_:

• d3osxa_ first appeared in SCOPe 2.01
  
• d3osxa_ appears in SCOPe 2.03
  
• d3osxa_ appears in the current release, SCOPe 2.08, called d3osxa1