Lineage for d3orhc_ (3orh C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893321Family c.66.1.16: Guanidinoacetate methyltransferase [69550] (1 protein)
  6. 2893322Protein Guanidinoacetate methyltransferase [69551] (2 species)
    a template structure of protein arginine methyltransferase
  7. 2893323Species Human (Homo sapiens) [TaxId:9606] [142580] (2 PDB entries)
    Uniprot Q14353 8-236
  8. 2893326Domain d3orhc_: 3orh C: [183250]
    automated match to d3orha_
    complexed with sah

Details for d3orhc_

PDB Entry: 3orh (more details), 1.86 Å

PDB Description: Human guanidinoacetate N-methyltransferase with SAH
PDB Compounds: (C:) Guanidinoacetate N-methyltransferase

SCOPe Domain Sequences for d3orhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3orhc_ c.66.1.16 (C:) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]}
tpifapgencspawgaapaaydaadthlrilgkpvmerwetpymhalaaaasskggrvle
vgfgmaiaaskvqeapidehwiiecndgvfqrlrdwaprqthkviplkglwedvaptlpd
ghfdgilydtyplseetwhthqfnfiknhafrllkpggvltycnltswgelmkskysdit
imfeetqvpalleagfrrenirtevmalvppadcryyafpqmitplvtkg

SCOPe Domain Coordinates for d3orhc_:

Click to download the PDB-style file with coordinates for d3orhc_.
(The format of our PDB-style files is described here.)

Timeline for d3orhc_: