![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.16: Guanidinoacetate methyltransferase [69550] (1 protein) |
![]() | Protein Guanidinoacetate methyltransferase [69551] (2 species) a template structure of protein arginine methyltransferase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142580] (2 PDB entries) Uniprot Q14353 8-236 |
![]() | Domain d3orhc_: 3orh C: [183250] automated match to d3orha_ complexed with sah |
PDB Entry: 3orh (more details), 1.86 Å
SCOPe Domain Sequences for d3orhc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3orhc_ c.66.1.16 (C:) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} tpifapgencspawgaapaaydaadthlrilgkpvmerwetpymhalaaaasskggrvle vgfgmaiaaskvqeapidehwiiecndgvfqrlrdwaprqthkviplkglwedvaptlpd ghfdgilydtyplseetwhthqfnfiknhafrllkpggvltycnltswgelmkskysdit imfeetqvpalleagfrrenirtevmalvppadcryyafpqmitplvtkg
Timeline for d3orhc_: