Lineage for d1afvb_ (1afv B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540286Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 540287Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) (S)
  5. 540288Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (5 proteins)
  6. 540302Protein HIV-1 capsid protein [47945] (1 species)
  7. 540303Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (11 PDB entries)
  8. 540324Domain d1afvb_: 1afv B: [18325]
    Other proteins in same PDB: d1afvh1, d1afvh2, d1afvk1, d1afvk2, d1afvl1, d1afvl2, d1afvm1, d1afvm2
    complexed with pb

Details for d1afvb_

PDB Entry: 1afv (more details), 3.7 Å

PDB Description: hiv-1 capsid protein (p24) complex with fab25.3

SCOP Domain Sequences for d1afvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afvb_ a.73.1.1 (B:) HIV-1 capsid protein {Human immunodeficiency virus type 1}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysptsil

SCOP Domain Coordinates for d1afvb_:

Click to download the PDB-style file with coordinates for d1afvb_.
(The format of our PDB-style files is described here.)

Timeline for d1afvb_: