Lineage for d1afvb_ (1afv B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) 
Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (4 proteins) 
Protein HIV-1 capsid protein [47945] (1 species) Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (6 PDB entries) 
Domain d1afvb_: 1afv B: [18325]
Other proteins in same PDB: d1afvh1, d1afvh2, d1afvk1, d1afvk2, d1afvl1, d1afvl2, d1afvm1, d1afvm2
Details for d1afvb_
PDB Entry: 1afv (more details), 3.7 Å
PDB Description: hiv-1 capsid protein (p24) complex with fab25.3
SCOP Domain Sequences for d1afvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1afvb_ a.73.1.1 (B:) HIV-1 capsid protein {Human immunodeficiency virus type 1}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysptsil
SCOP Domain Coordinates for d1afvb_:
Click to download the PDB-style file with coordinates for d1afvb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1afvb_:
- d1afvb_ appears in SCOP 1.57
- d1afvb_ appears in the current release, SCOPe 2.08
View in 3D
