Lineage for d1afvb_ (1afv B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2717857Protein HIV-1 capsid protein [47945] (1 species)
  7. 2717858Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)
  8. 2717979Domain d1afvb_: 1afv B: [18325]
    Other proteins in same PDB: d1afvh1, d1afvh2, d1afvk1, d1afvk2, d1afvl1, d1afvl2, d1afvm1, d1afvm2
    complexed with pb

Details for d1afvb_

PDB Entry: 1afv (more details), 3.7 Å

PDB Description: hiv-1 capsid protein (p24) complex with fab25.3
PDB Compounds: (B:) human immunodeficiency virus type 1 capsid protein

SCOPe Domain Sequences for d1afvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afvb_ a.73.1.1 (B:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysptsil

SCOPe Domain Coordinates for d1afvb_:

Click to download the PDB-style file with coordinates for d1afvb_.
(The format of our PDB-style files is described here.)

Timeline for d1afvb_: