Lineage for d3or6c_ (3or6 C:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577060Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2577061Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2577062Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2577167Protein automated matches [190184] (3 species)
    not a true protein
  7. 2577176Species Streptomyces lividans [TaxId:1916] [186922] (11 PDB entries)
  8. 2577182Domain d3or6c_: 3or6 C: [183246]
    Other proteins in same PDB: d3or6a1, d3or6a2, d3or6a3, d3or6b1, d3or6b2
    automated match to d1k4cc_
    complexed with k

Details for d3or6c_

PDB Entry: 3or6 (more details), 2.7 Å

PDB Description: on the structural basis of modal gating behavior in k+channels - e71q
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d3or6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3or6c_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvqtattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOPe Domain Coordinates for d3or6c_:

Click to download the PDB-style file with coordinates for d3or6c_.
(The format of our PDB-style files is described here.)

Timeline for d3or6c_: