SCOPe 2.06: Domain d3or5a_: 3or5 A:

Lineage for d3or5a_ (3or5 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Chlorobaculum tepidum [TaxId:1097] [189480] (1 PDB entry)

8. Domain d3or5a_: 3or5 A: [183245]
   automated match to d1st9a_

Details for d3or5a_

PDB Entry: 3or5, 1.66 Å

PDB Description: crystal structure of thiol:disulfide interchange protein, thioredoxin family protein from chlorobium tepidum tls

PDB Compounds: (A:) Thiol:disulfide interchange protein, thioredoxin family protein

SCOPe Domain Sequences for d3or5a_:

Sequence; same for both SEQRES and ATOM records:

>d3or5a_ c.47.1.0 (A:) automated matches {Chlorobaculum tepidum [TaxId: 1097]}
adarptpapsfsgvtvdgkpfssaslkgkayivnffatwcppcrseipdmvqvqktwasr
gftfvgiavneqlpnvknymktqgiiypvmmatpelirafngyidggitgiptsfvidas
gnvsgvivgprskadfdrivkmalg

Timeline for d3or5a_:

• d3or5a_ first appeared in SCOPe 2.01
  
• d3or5a_ appears in SCOPe 2.05
  
• d3or5a_ appears in SCOPe 2.07
  
• d3or5a_ appears in the current release, SCOPe 2.08