Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d3or2f_ (3or2 F:)

  1. Root: SCOP 1.75B
  2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. Fold d.203: DsrC, the gamma subunit of dissimilatory sulfite reductase [69720] (1 superfamily)
    beta(3)-alpha(5); meander beta-sheet packed against array of helices
  4. Superfamily d.203.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69721] (2 families) (S)
  5. Family d.203.1.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69722] (2 protein domains)
  6. Protein automated matches [191191] (2 species)
    not a true protein
  7. Species Desulfovibrio gigas [TaxId:879] [189481] (2 PDB entries)
  8. Domain d3or2f_: 3or2 F: [183244]
    automated match to d2v4jc1
    complexed with sf4, so3, srm

Details for d3or2f_

PDB Entry: 3or2 (more details)
PDB Description: crystal structure of dissimilatory sulfite reductase ii (dsr
PDB Compounds: (F:) Sulfite redcutase subunit gama

SCOP Domain Sequences for d3or2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3or2f_ d.203.1.1 (F:) automated matches {Desulfovibrio gigas [TaxId: 879]}
avvefagsafevdedgflnafddwcpewvkyakgsegigagsadhqkiidflqdyykang
iapmvrilskvtgfklkqiyelfpsgpgkgackmaglpkptgcv

SCOP Domain Coordinates for d3or2f_:

Click to download the PDB-style file with coordinates for d3or2f_.
(The format of our PDB-style files is described here.)

Timeline for d3or2f_:

d3or2f_ appears in SCOP 1.75A


d3or2f_
(click for larger image)


d3or2f_ in context of chain



d3or2f_ in context of PDB
Domains from other chains:
d3or2c_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu