SCOPe 2.08: Domain d3or1f_: 3or1 F:

Lineage for d3or1f_ (3or1 F:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.203: DsrC, the gamma subunit of dissimilatory sulfite reductase [69720] (1 superfamily)
   beta(3)-alpha(5); meander beta-sheet packed against array of helices

4. Superfamily d.203.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69721] (2 families)

5. Family d.203.1.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69722] (2 proteins)
   automatically mapped to Pfam PF04358

6. Protein automated matches [191191] (2 species)
   not a true protein

7. Species Desulfovibrio gigas [TaxId:879] [189481] (2 PDB entries)

8. Domain d3or1f_: 3or1 F: [183242]
   automated match to d2v4jc1
   complexed with sf4, so3, srm

Details for d3or1f_

PDB Entry: 3or1, 1.76 Å

PDB Description: Crystal structure of dissimilatory sulfite reductase I (DsrI)

PDB Compounds: (F:) Sulfite reductase gama

SCOPe Domain Sequences for d3or1f_:

Sequence; same for both SEQRES and ATOM records:

>d3or1f_ d.203.1.1 (F:) automated matches {Desulfovibrio gigas [TaxId: 879]}
avvefagsafevdedgflnafddwcpewvkyakgsegigagsadhqkiidflqdyykang
iapmvrilskntgfalkeiyelfpsgpgkgackmaglpkptgcv

Timeline for d3or1f_:

• d3or1f_ first appeared in SCOPe 2.01
  
• d3or1f_ appears in SCOPe 2.07