Class b: All beta proteins [48724] (180 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
Protein Chymosin (synonym: renin) [50667] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [50669] (77 PDB entries) |
Domain d3oqka_: 3oqk A: [183238] automated match to d1bila_ complexed with gol, nag, s52 |
PDB Entry: 3oqk (more details), 2.9 Å
SCOPe Domain Sequences for d3oqka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oqka_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdp qhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklm ealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaiham dippptgptwalgatfirkfytefdrrnnrigfalar
Timeline for d3oqka_: