Lineage for d3oq3a_ (3oq3 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705784Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 2705886Protein automated matches [190141] (2 species)
    not a true protein
  7. 2705894Species Mouse (Mus musculus) [TaxId:10090] [189956] (3 PDB entries)
  8. 2705895Domain d3oq3a_: 3oq3 A: [183231]
    automated match to d1itfa_
    complexed with act, cl, edo, epe, zn

Details for d3oq3a_

PDB Entry: 3oq3 (more details), 2.1 Å

PDB Description: Structural Basis of Type-I Interferon Sequestration by a Poxvirus Decoy Receptor
PDB Compounds: (A:) Interferon alpha-5

SCOPe Domain Sequences for d3oq3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oq3a_ a.26.1.3 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cdlpqthnlrnkraltllvkmrrlsplsclkdrkdfgfpqekvgaqqiqeaqaipvlsel
tqqvlniftskdssaawnatlldsfcnevhqqlndlkacvmqqvgvqespltqedsllav
rkyfhritvylrekkhspcawevvraevwralsssvnllarlskee

SCOPe Domain Coordinates for d3oq3a_:

Click to download the PDB-style file with coordinates for d3oq3a_.
(The format of our PDB-style files is described here.)

Timeline for d3oq3a_: