Lineage for d1e6jp2 (1e6j P:11-147)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273716Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 1273717Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 1273718Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 1273757Protein HIV-1 capsid protein [47945] (1 species)
  7. 1273758Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (25 PDB entries)
  8. 1273808Domain d1e6jp2: 1e6j P:11-147 [18323]
    Other proteins in same PDB: d1e6jh1, d1e6jh2, d1e6jl1, d1e6jl2, d1e6jp1

Details for d1e6jp2

PDB Entry: 1e6j (more details), 3 Å

PDB Description: crystal structure of hiv-1 capsid protein (p24) in complex with fab13b5
PDB Compounds: (P:) capsid protein p24

SCOPe Domain Sequences for d1e6jp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6jp2 a.73.1.1 (P:11-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
vhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlk
etineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiy
krwiilglnkivrmysp

SCOPe Domain Coordinates for d1e6jp2:

Click to download the PDB-style file with coordinates for d1e6jp2.
(The format of our PDB-style files is described here.)

Timeline for d1e6jp2: