Lineage for d1e6jp2 (1e6j P:11-147)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215315Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 215316Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) (S)
  5. 215317Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (4 proteins)
  6. 215323Protein HIV-1 capsid protein [47945] (1 species)
  7. 215324Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (8 PDB entries)
  8. 215327Domain d1e6jp2: 1e6j P:11-147 [18323]
    Other proteins in same PDB: d1e6jh1, d1e6jh2, d1e6jl1, d1e6jl2, d1e6jp1
    mutant

Details for d1e6jp2

PDB Entry: 1e6j (more details), 3 Å

PDB Description: crystal structure of hiv-1 capsid protein (p24) in complex with fab13b5

SCOP Domain Sequences for d1e6jp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6jp2 a.73.1.1 (P:11-147) HIV-1 capsid protein {Human immunodeficiency virus type 1}
vhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlk
etineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiy
krwiilglnkivrmysp

SCOP Domain Coordinates for d1e6jp2:

Click to download the PDB-style file with coordinates for d1e6jp2.
(The format of our PDB-style files is described here.)

Timeline for d1e6jp2: