Lineage for d3opqa_ (3opq A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857183Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 2857184Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 proteins)
    automatically mapped to Pfam PF00731
  6. 2857234Protein automated matches [191111] (4 species)
    not a true protein
  7. 2857272Species Francisella tularensis [TaxId:119856] [189466] (2 PDB entries)
  8. 2857281Domain d3opqa_: 3opq A: [183223]
    automated match to d1xmpc_
    complexed with cl, f6r, fmt, po4

Details for d3opqa_

PDB Entry: 3opq (more details), 2 Å

PDB Description: phosphoribosylaminoimidazole carboxylase with fructose-6-phosphate bound to the central channel of the octameric protein structure.
PDB Compounds: (A:) Phosphoribosylaminoimidazole carboxylase,catalytic subunit

SCOPe Domain Sequences for d3opqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3opqa_ c.23.8.1 (A:) automated matches {Francisella tularensis [TaxId: 119856]}
svqvgvimgsksdwstmkeccdildnlgigyecevvsahrtpdkmfdyaetakerglkvi
iagaggaahlpgmvaakttlpvlgvpvksstlngqdsllsivqmpagipvatfaigmaga
knaalfaasilqhtdiniakalaefraeqtrfvlenpdpr

SCOPe Domain Coordinates for d3opqa_:

Click to download the PDB-style file with coordinates for d3opqa_.
(The format of our PDB-style files is described here.)

Timeline for d3opqa_: