SCOPe 2.08: Domain d3opkc1: 3opk C:1-115

Lineage for d3opkc1 (3opk C:1-115)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)

6. Protein automated matches [191031] (3 species)
   not a true protein

7. Species Salmonella enterica [TaxId:99287] [189500] (1 PDB entry)

8. Domain d3opkc1: 3opk C:1-115 [183222]
   Other proteins in same PDB: d3opkc2
   automated match to d1naqa_
   complexed with act, mg, na

Details for d3opkc1

PDB Entry: 3opk, 1.9 Å

PDB Description: Crystal structure of divalent-cation tolerance protein CutA from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2

PDB Compounds: (C:) Divalent-cation tolerance protein cutA

SCOPe Domain Sequences for d3opkc1:

Sequence; same for both SEQRES and ATOM records:

>d3opkc1 d.58.5.2 (C:1-115) automated matches {Salmonella enterica [TaxId: 99287]}
mldvksqdisipeavvvlctapdeataqdlaakvlaeklaacatllpgatslyywegkle
qeyevqmilkttvshqqalidclkshhpyqtpellvlpvthgdtdylswlnaslr

Timeline for d3opkc1:

• d3opkc1 first appeared in SCOPe 2.01, called d3opkc_
  
• d3opkc1 appears in SCOPe 2.07