Lineage for d3opkc1 (3opk C:1-115)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950720Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)
  6. 2950826Protein automated matches [191031] (3 species)
    not a true protein
  7. 2950831Species Salmonella enterica [TaxId:99287] [189500] (1 PDB entry)
  8. 2950834Domain d3opkc1: 3opk C:1-115 [183222]
    Other proteins in same PDB: d3opkc2
    automated match to d1naqa_
    complexed with act, mg, na

Details for d3opkc1

PDB Entry: 3opk (more details), 1.9 Å

PDB Description: Crystal structure of divalent-cation tolerance protein CutA from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
PDB Compounds: (C:) Divalent-cation tolerance protein cutA

SCOPe Domain Sequences for d3opkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3opkc1 d.58.5.2 (C:1-115) automated matches {Salmonella enterica [TaxId: 99287]}
mldvksqdisipeavvvlctapdeataqdlaakvlaeklaacatllpgatslyywegkle
qeyevqmilkttvshqqalidclkshhpyqtpellvlpvthgdtdylswlnaslr

SCOPe Domain Coordinates for d3opkc1:

Click to download the PDB-style file with coordinates for d3opkc1.
(The format of our PDB-style files is described here.)

Timeline for d3opkc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3opkc2