Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins) |
Protein automated matches [191031] (3 species) not a true protein |
Species Salmonella enterica [TaxId:99287] [189500] (1 PDB entry) |
Domain d3opka_: 3opk A: [183220] automated match to d1naqa_ complexed with act, mg, na |
PDB Entry: 3opk (more details), 1.9 Å
SCOPe Domain Sequences for d3opka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3opka_ d.58.5.2 (A:) automated matches {Salmonella enterica [TaxId: 99287]} peavvvlctapdeataqdlaakvlaeklaacatllpgatslyywegkleqeyevqmilkt tvshqqalidclkshhpyqtpellvlpvthgdtdylswlnaslr
Timeline for d3opka_: