Lineage for d3opka_ (3opk A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1907450Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1907588Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)
  6. 1907670Protein automated matches [191031] (3 species)
    not a true protein
  7. 1907675Species Salmonella enterica [TaxId:99287] [189500] (1 PDB entry)
  8. 1907676Domain d3opka_: 3opk A: [183220]
    automated match to d1naqa_
    complexed with act, mg, na

Details for d3opka_

PDB Entry: 3opk (more details), 1.9 Å

PDB Description: Crystal structure of divalent-cation tolerance protein CutA from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
PDB Compounds: (A:) Divalent-cation tolerance protein cutA

SCOPe Domain Sequences for d3opka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3opka_ d.58.5.2 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
peavvvlctapdeataqdlaakvlaeklaacatllpgatslyywegkleqeyevqmilkt
tvshqqalidclkshhpyqtpellvlpvthgdtdylswlnaslr

SCOPe Domain Coordinates for d3opka_:

Click to download the PDB-style file with coordinates for d3opka_.
(The format of our PDB-style files is described here.)

Timeline for d3opka_: