![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) ![]() |
![]() | Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 proteins) automatically mapped to Pfam PF00731 |
![]() | Protein automated matches [191111] (3 species) not a true protein |
![]() | Species Francisella tularensis [TaxId:119856] [189466] (2 PDB entries) |
![]() | Domain d3oowd_: 3oow D: [183212] automated match to d1xmpc_ complexed with cl, fmt, mpd, po4 |
PDB Entry: 3oow (more details), 1.75 Å
SCOPe Domain Sequences for d3oowd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oowd_ c.23.8.1 (D:) automated matches {Francisella tularensis [TaxId: 119856]} svqvgvimgsksdwstmkeccdildnlgigyecevvsahrtpdkmfdyaetakerglkvi iagaggaahlpgmvaakttlpvlgvpvksstlngqdsllsivqmpagipvatfaigmaga knaalfaasilqhtdiniakalaefraeqtrfvlenpdpreh
Timeline for d3oowd_: