Class a: All alpha proteins [46456] (289 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein automated matches [190059] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries) |
Domain d3oofc1: 3oof C:248-476 [183204] Other proteins in same PDB: d3oofa2, d3oofc2 automated match to d1osha_ protein/DNA complex; complexed with oof |
PDB Entry: 3oof (more details), 2.29 Å
SCOPe Domain Sequences for d3oofc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oofc1 a.123.1.1 (C:248-476) automated matches {Human (Homo sapiens) [TaxId: 9606]} eltpdqqtllhfimdsynkqrmpqeitnkilkeafsaeenfliltematnhvqvlveftk klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdllearirnsgisdeyit pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq penpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq
Timeline for d3oofc1: