SCOPe 2.05: Domain d3oofc_: 3oof C:

Lineage for d3oofc_ (3oof C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (138 PDB entries)

8. Domain d3oofc_: 3oof C: [183204]
   automated match to d1osha_
   protein/DNA complex; complexed with oof

Details for d3oofc_

PDB Entry: 3oof, 2.29 Å

PDB Description: crystal structure of human fxr in complex with 4-({(2s)-2-[2-(4- chlorophenyl)-5,6-difluoro-1h-benzimidazol-1-yl]-2- cyclohexylacetyl}amino)benzoic acid

PDB Compounds: (C:) Bile acid receptor

SCOPe Domain Sequences for d3oofc_:

Sequence; same for both SEQRES and ATOM records:

>d3oofc_ a.123.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meltpdqqtllhfimdsynkqrmpqeitnkilkeafsaeenfliltematnhvqvlveft
kklpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdllearirnsgisdeyi
tpmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckih
qpenpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq

Timeline for d3oofc_:

• d3oofc_ first appeared in SCOPe 2.01
  
• d3oofc_ appears in SCOPe 2.04
  
• d3oofc_ is called d3oofc1 in SCOPe 2.06
  
• d3oofc_ appears in the current release, SCOPe 2.08, called d3oofc1