Lineage for d3ooda_ (3ood A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096081Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2096195Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
    automatically mapped to Pfam PF02126
  6. 2096196Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (4 species)
  7. 2096197Species Agrobacterium tumefaciens [TaxId:358] [141815] (16 PDB entries)
    Uniprot Q93LD7 32-360
  8. 2096204Domain d3ooda_: 3ood A: [183202]
    automated match to d2d2ga1
    complexed with co, epl; mutant

Details for d3ooda_

PDB Entry: 3ood (more details), 1.89 Å

PDB Description: structure of opda y257f mutant soaked with diethyl 4-methoxyphenyl phosphate for 20 hours.
PDB Compounds: (A:) phosphotriesterase

SCOPe Domain Sequences for d3ooda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ooda_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Agrobacterium tumefaciens [TaxId: 358]}
tgdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalaekavrglrhars
agvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltqfflr
eiqhgiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtsasqrdgeqq
aaifeseglspsrvcighsddtddlsyltglaargylvgldrmpfsaiglegnasalalf
gtrswqtrallikalidrgykdrilvshdwlfgfssyvtnimdvmdrinpdgmafvplrv
ipflrekgvppetlagvtvanparflspt

SCOPe Domain Coordinates for d3ooda_:

Click to download the PDB-style file with coordinates for d3ooda_.
(The format of our PDB-style files is described here.)

Timeline for d3ooda_: