Class a: All alpha proteins [46456] (286 folds) |
Fold a.72: Functional domain of the splicing factor Prp18 [47937] (1 superfamily) core: 5 helices; bundle |
Superfamily a.72.1: Functional domain of the splicing factor Prp18 [47938] (1 family) automatically mapped to Pfam PF02840 |
Family a.72.1.1: Functional domain of the splicing factor Prp18 [47939] (1 protein) |
Protein Functional domain of the splicing factor Prp18 [47940] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47941] (1 PDB entry) |
Domain d1dvkb_: 1dvk B: [18320] |
PDB Entry: 1dvk (more details), 2.15 Å
SCOPe Domain Sequences for d1dvkb_:
Sequence, based on SEQRES records: (download)
>d1dvkb_ a.72.1.1 (B:) Functional domain of the splicing factor Prp18 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mriqeaiaqdktisviidpsqigstegkpllsmkcnlyiheilsrwkasleayhpelfld tkkalfplllqlrrnqlapdllislatvlyhlqqpkeinlavqsymklsignvawpigvt svgiharsahskiqggrnaanimidertrlwitsikrlitfeewytsnh
>d1dvkb_ a.72.1.1 (B:) Functional domain of the splicing factor Prp18 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mriqeaiaqdktisviidpsqigstegkpllsmkcnlyiheilsrwkasleayhpelfld tkkalfplllqlrrnqlapdllislatvlyhlqqpkeinlavqsymklsignvawpigvt animidertrlwitsikrlitfeewytsnh
Timeline for d1dvkb_: