Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein automated matches [190124] (12 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189599] (1 PDB entry) |
Domain d3ongd_: 3ong D: [183193] automated match to d1kpsa_ |
PDB Entry: 3ong (more details), 2.3 Å
SCOPe Domain Sequences for d3ongd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ongd_ d.20.1.1 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} smsslclqrlqeerkkwrkdhpfgfyakpvkkadgsmdlqkweagipgkegtnwaggvyp itveypneypskppkvkfpagfyhpnvypsgticlsilnedqdwrpaitlkqivlgvqdl ldspnpnspaqepawrsfsrnkaeydkkvllqakqys
Timeline for d3ongd_: