Lineage for d3ongd_ (3ong D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1406945Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1406946Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1406947Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1407111Protein automated matches [190124] (12 species)
    not a true protein
  7. 1407112Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189599] (1 PDB entry)
  8. 1407114Domain d3ongd_: 3ong D: [183193]
    automated match to d1kpsa_

Details for d3ongd_

PDB Entry: 3ong (more details), 2.3 Å

PDB Description: crystal structure of uba2ufd-ubc9: insights into e1-e2 interactions in sumo pathways
PDB Compounds: (D:) SUMO-conjugating enzyme UBC9

SCOPe Domain Sequences for d3ongd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ongd_ d.20.1.1 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
smsslclqrlqeerkkwrkdhpfgfyakpvkkadgsmdlqkweagipgkegtnwaggvyp
itveypneypskppkvkfpagfyhpnvypsgticlsilnedqdwrpaitlkqivlgvqdl
ldspnpnspaqepawrsfsrnkaeydkkvllqakqys

SCOPe Domain Coordinates for d3ongd_:

Click to download the PDB-style file with coordinates for d3ongd_.
(The format of our PDB-style files is described here.)

Timeline for d3ongd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ongb_