SCOPe 2.08: Domain d3ongd1: 3ong D:1-156

Lineage for d3ongd1 (3ong D:1-156)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189599] (2 PDB entries)

8. Domain d3ongd1: 3ong D:1-156 [183193]
   Other proteins in same PDB: d3ongb2, d3ongd2
   automated match to d1kpsa_

Details for d3ongd1

PDB Entry: 3ong, 2.3 Å

PDB Description: crystal structure of uba2ufd-ubc9: insights into e1-e2 interactions in sumo pathways

PDB Compounds: (D:) SUMO-conjugating enzyme UBC9

SCOPe Domain Sequences for d3ongd1:

Sequence; same for both SEQRES and ATOM records:

>d3ongd1 d.20.1.1 (D:1-156) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msslclqrlqeerkkwrkdhpfgfyakpvkkadgsmdlqkweagipgkegtnwaggvypi
tveypneypskppkvkfpagfyhpnvypsgticlsilnedqdwrpaitlkqivlgvqdll
dspnpnspaqepawrsfsrnkaeydkkvllqakqys

Timeline for d3ongd1:

• d3ongd1 first appeared in SCOPe 2.01, called d3ongd_
  
• d3ongd1 appears in SCOPe 2.07