Lineage for d3on6b_ (3on6 B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 920404Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 920405Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 920586Family a.102.1.8: CPF0428-like [158737] (3 proteins)
    Pfam PF06824; DUF1237
  6. 920596Protein automated matches [191186] (1 species)
    not a true protein
  7. 920597Species Bacteroides ovatus [TaxId:411476] [189465] (2 PDB entries)
  8. 920601Domain d3on6b_: 3on6 B: [183189]
    automated match to d2p0va1
    complexed with cl, edo, peg

Details for d3on6b_

PDB Entry: 3on6 (more details), 1.7 Å

PDB Description: crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution
PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d3on6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3on6b_ a.102.1.8 (B:) automated matches {Bacteroides ovatus [TaxId: 411476]}
yqtnrpetskrlfvsqaveqqiahikqlltnarlawmfencfpntldttvhfdgkddtfv
ytgdihamwlrdsgaqvwpyvqlankdaelkkmlagvikrqfkcinidpyanafnmnseg
gewmsdltdmkpelherkweidslcypirlayhywkttgdasifsdewltaiakvlktfk
eqqrkedpkgpyrfqrkteraldtmtndgwgnpvkpvgliasafrpsddattfqflvpsn
ffavtslrkaaeilntvnkkpdlakecttlsneveaalkkyavynhpkygkiyafevdgf
gnqllmddanvpslialpylgdvkvndpiyqntrkfvwsednpyffkgtagegiggphig
ydmiwpmsimmkaftsqndaeiktcikmlmdtdagtgfmhesfhkndpknftrswfawqn
tlfgelilklvnegkvdllnsiq

SCOPe Domain Coordinates for d3on6b_:

Click to download the PDB-style file with coordinates for d3on6b_.
(The format of our PDB-style files is described here.)

Timeline for d3on6b_: