Class a: All alpha proteins [46456] (284 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) |
Family a.102.1.8: CPF0428-like [158737] (3 proteins) Pfam PF06824; DUF1237 |
Protein automated matches [191186] (1 species) not a true protein |
Species Bacteroides ovatus [TaxId:411476] [189465] (2 PDB entries) |
Domain d3on6b_: 3on6 B: [183189] automated match to d2p0va1 complexed with cl, edo, peg |
PDB Entry: 3on6 (more details), 1.7 Å
SCOPe Domain Sequences for d3on6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3on6b_ a.102.1.8 (B:) automated matches {Bacteroides ovatus [TaxId: 411476]} yqtnrpetskrlfvsqaveqqiahikqlltnarlawmfencfpntldttvhfdgkddtfv ytgdihamwlrdsgaqvwpyvqlankdaelkkmlagvikrqfkcinidpyanafnmnseg gewmsdltdmkpelherkweidslcypirlayhywkttgdasifsdewltaiakvlktfk eqqrkedpkgpyrfqrkteraldtmtndgwgnpvkpvgliasafrpsddattfqflvpsn ffavtslrkaaeilntvnkkpdlakecttlsneveaalkkyavynhpkygkiyafevdgf gnqllmddanvpslialpylgdvkvndpiyqntrkfvwsednpyffkgtagegiggphig ydmiwpmsimmkaftsqndaeiktcikmlmdtdagtgfmhesfhkndpknftrswfawqn tlfgelilklvnegkvdllnsiq
Timeline for d3on6b_: