SCOPe 2.01: Domain d3on6a_: 3on6 A:

Lineage for d3on6a_ (3on6 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.8: CPF0428-like [158737] (3 proteins)
   Pfam PF06824; DUF1237

6. Protein automated matches [191186] (1 species)
   not a true protein

7. Species Bacteroides ovatus [TaxId:411476] [189465] (2 PDB entries)

8. Domain d3on6a_: 3on6 A: [183188]
   automated match to d2p0va1
   complexed with cl, edo, peg

Details for d3on6a_

PDB Entry: 3on6, 1.7 Å

PDB Description: crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution

PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d3on6a_:

Sequence; same for both SEQRES and ATOM records:

>d3on6a_ a.102.1.8 (A:) automated matches {Bacteroides ovatus [TaxId: 411476]}
yqtnrpetskrlfvsqaveqqiahikqlltnarlawmfencfpntldttvhfdgkddtfv
ytgdihamwlrdsgaqvwpyvqlankdaelkkmlagvikrqfkcinidpyanafnmnseg
gewmsdltdmkpelherkweidslcypirlayhywkttgdasifsdewltaiakvlktfk
eqqrkedpkgpyrfqrkteraldtmtndgwgnpvkpvgliasafrpsddattfqflvpsn
ffavtslrkaaeilntvnkkpdlakecttlsneveaalkkyavynhpkygkiyafevdgf
gnqllmddanvpslialpylgdvkvndpiyqntrkfvwsednpyffkgtagegiggphig
ydmiwpmsimmkaftsqndaeiktcikmlmdtdagtgfmhesfhkndpknftrswfawqn
tlfgelilklvnegkvdllnsiq

Timeline for d3on6a_:

• d3on6a_ is new in SCOPe 2.01-stable
  
• d3on6a_ appears in SCOPe 2.02
  
• d3on6a_ appears in the current release, SCOPe 2.08