| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) ![]() dimer of identical subunits |
| Family a.55.1.0: automated matches [191573] (1 protein) not a true family |
| Protein automated matches [191007] (11 species) not a true protein |
| Species Escherichia coli [TaxId:562] [189967] (1 PDB entry) |
| Domain d3omya_: 3omy A: [183186] automated match to d1dp3a_ complexed with gol, mg |
PDB Entry: 3omy (more details), 1.3 Å
SCOPe Domain Sequences for d3omya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3omya_ a.55.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
pkiqtyvnnnvyeqitdlvtirkqegieeaslsnvssmllelglrvymiqq
Timeline for d3omya_: