Lineage for d3omya_ (3omy A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715141Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2715142Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2715207Family a.55.1.0: automated matches [191573] (1 protein)
    not a true family
  6. 2715208Protein automated matches [191007] (11 species)
    not a true protein
  7. 2715214Species Escherichia coli [TaxId:562] [189967] (1 PDB entry)
  8. 2715215Domain d3omya_: 3omy A: [183186]
    automated match to d1dp3a_
    complexed with gol, mg

Details for d3omya_

PDB Entry: 3omy (more details), 1.3 Å

PDB Description: Crystal structure of the pED208 TraM N-terminal domain
PDB Compounds: (A:) Protein traM

SCOPe Domain Sequences for d3omya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3omya_ a.55.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
pkiqtyvnnnvyeqitdlvtirkqegieeaslsnvssmllelglrvymiqq

SCOPe Domain Coordinates for d3omya_:

Click to download the PDB-style file with coordinates for d3omya_.
(The format of our PDB-style files is described here.)

Timeline for d3omya_: