Lineage for d3omqb_ (3omq B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008714Protein Estrogen receptor beta [48521] (2 species)
  7. 2008715Species Human (Homo sapiens) [TaxId:9606] [48522] (26 PDB entries)
  8. 2008720Domain d3omqb_: 3omq B: [183184]
    automated match to d1l2ja_
    complexed with w23

Details for d3omqb_

PDB Entry: 3omq (more details), 1.97 Å

PDB Description: Fragment-Based Design of novel Estrogen Receptor Ligands
PDB Compounds: (B:) Estrogen receptor beta

SCOPe Domain Sequences for d3omqb_:

Sequence, based on SEQRES records: (download)

>d3omqb_ a.123.1.1 (B:) Estrogen receptor beta {Human (Homo sapiens) [TaxId: 9606]}
speqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvels
lfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmllat
tsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvwviak
sgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydllleml

Sequence, based on observed residues (ATOM records): (download)

>d3omqb_ a.123.1.1 (B:) Estrogen receptor beta {Human (Homo sapiens) [TaxId: 9606]}
speqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvels
lfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmllat
tsrfrelklqhkeylcvkamillnssmyplvtaklahllnavtdalvwviaksgissqqq
smrlanllmllshvrhasnkgmehllnmkcknvvpvydllleml

SCOPe Domain Coordinates for d3omqb_:

Click to download the PDB-style file with coordinates for d3omqb_.
(The format of our PDB-style files is described here.)

Timeline for d3omqb_: