Lineage for d3omnc_ (3omn C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3026966Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 3026967Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 3026968Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 3027098Protein automated matches [190134] (3 species)
    not a true protein
  7. 3027138Species Rhodobacter sphaeroides [TaxId:272943] [189626] (6 PDB entries)
  8. 3027144Domain d3omnc_: 3omn C: [183178]
    Other proteins in same PDB: d3omnb1, d3omnb2, d3omnb3, d3omnd1, d3omnd2, d3omnd3
    automated match to d1m56a_
    complexed with ca, cd, cl, cu1, dmu, hea, hth, mg, oh, trd; mutant

Details for d3omnc_

PDB Entry: 3omn (more details), 2.15 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with d132a mutation in the reduced state
PDB Compounds: (C:) Cytochrome c oxidase, aa3 type, subunit I

SCOPe Domain Sequences for d3omnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3omnc_ f.24.1.1 (C:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
wfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgffqs
lwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapamafprmn
nlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhlsga
ssilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltdrnf
gttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpmvya
mvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsielkt
pmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagiyfw
igkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfvssl
gaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppeht

SCOPe Domain Coordinates for d3omnc_:

Click to download the PDB-style file with coordinates for d3omnc_.
(The format of our PDB-style files is described here.)

Timeline for d3omnc_: