Lineage for d3ommc1 (3omm C:248-476)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2341332Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2342566Protein automated matches [190059] (14 species)
    not a true protein
  7. 2342588Species Human (Homo sapiens) [TaxId:9606] [187214] (212 PDB entries)
  8. 2342830Domain d3ommc1: 3omm C:248-476 [183176]
    Other proteins in same PDB: d3omma2, d3ommc2
    automated match to d1osha_
    protein/DNA complex; complexed with omm

Details for d3ommc1

PDB Entry: 3omm (more details), 2.1 Å

PDB Description: crystal structure of human fxr in complex with 4-({(2s)-2-[2-(4- chlorophenyl)-5,6-difluoro-1h-benzimidazol-1-yl]-2- cyclohexylacetyl}amino)-3-fluorobenzoic acid
PDB Compounds: (C:) Bile acid receptor

SCOPe Domain Sequences for d3ommc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ommc1 a.123.1.1 (C:248-476) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltpdqqtllhfimdsynkqrmpqeitnkilkeafsaeenfliltematnhvqvlveftk
klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdllearirnsgisdeyit
pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
penpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq

SCOPe Domain Coordinates for d3ommc1:

Click to download the PDB-style file with coordinates for d3ommc1.
(The format of our PDB-style files is described here.)

Timeline for d3ommc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ommc2