SCOPe 2.08: Domain d3ommc1: 3omm C:248-476

Lineage for d3ommc1 (3omm C:248-476)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)

8. Domain d3ommc1: 3omm C:248-476 [183176]
   Other proteins in same PDB: d3omma2, d3ommc2
   automated match to d1osha_
   protein/DNA complex; complexed with omm

Details for d3ommc1

PDB Entry: 3omm, 2.1 Å

PDB Description: crystal structure of human fxr in complex with 4-({(2s)-2-[2-(4- chlorophenyl)-5,6-difluoro-1h-benzimidazol-1-yl]-2- cyclohexylacetyl}amino)-3-fluorobenzoic acid

PDB Compounds: (C:) Bile acid receptor

SCOPe Domain Sequences for d3ommc1:

Sequence; same for both SEQRES and ATOM records:

>d3ommc1 a.123.1.1 (C:248-476) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltpdqqtllhfimdsynkqrmpqeitnkilkeafsaeenfliltematnhvqvlveftk
klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdllearirnsgisdeyit
pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
penpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq

Timeline for d3ommc1:

• d3ommc1 first appeared in SCOPe 2.01, called d3ommc_
  
• d3ommc1 appears in SCOPe 2.07