Lineage for d3omma_ (3omm A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923994Protein automated matches [190059] (10 species)
    not a true protein
  7. 924007Species Human (Homo sapiens) [TaxId:9606] [187214] (97 PDB entries)
  8. 924073Domain d3omma_: 3omm A: [183175]
    automated match to d1osha_
    protein/DNA complex; complexed with omm

Details for d3omma_

PDB Entry: 3omm (more details), 2.1 Å

PDB Description: crystal structure of human fxr in complex with 4-({(2s)-2-[2-(4- chlorophenyl)-5,6-difluoro-1h-benzimidazol-1-yl]-2- cyclohexylacetyl}amino)-3-fluorobenzoic acid
PDB Compounds: (A:) Bile acid receptor

SCOPe Domain Sequences for d3omma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3omma_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meltpdqqtllhfimdsynkqrmpqeitnkilkeafsaeenfliltematnhvqvlveft
kklpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdllearirnsgisdeyi
tpmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckih
qpenpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq

SCOPe Domain Coordinates for d3omma_:

Click to download the PDB-style file with coordinates for d3omma_.
(The format of our PDB-style files is described here.)

Timeline for d3omma_: