![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
![]() | Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
![]() | Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
![]() | Protein automated matches [190059] (10 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187214] (97 PDB entries) |
![]() | Domain d3omkc_: 3omk C: [183174] automated match to d1osha_ protein/DNA complex; complexed with omk |
PDB Entry: 3omk (more details), 1.9 Å
SCOPe Domain Sequences for d3omkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3omkc_ a.123.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} meltpdqqtllhfimdsynkqrmpqeitnkilkeafsaeenfliltematnhvqvlveft kklpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdllearirnsgisdeyi tpmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckih qpenpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq
Timeline for d3omkc_: