SCOPe 2.01: Domain d3omkc_: 3omk C:

Lineage for d3omkc_ (3omk C:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (97 PDB entries)

8. Domain d3omkc_: 3omk C: [183174]
   automated match to d1osha_
   protein/DNA complex; complexed with omk

Details for d3omkc_

PDB Entry: 3omk, 1.9 Å

PDB Description: crystal structure of human fxr in complex with (2s)-2-[2-(4- chlorophenyl)-5,6-difluoro-1h-benzimidazol-1-yl]-2-cyclohexyl-n-(2- methylphenyl)ethanamide

PDB Compounds: (C:) Bile acid receptor

SCOPe Domain Sequences for d3omkc_:

Sequence; same for both SEQRES and ATOM records:

>d3omkc_ a.123.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meltpdqqtllhfimdsynkqrmpqeitnkilkeafsaeenfliltematnhvqvlveft
kklpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdllearirnsgisdeyi
tpmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckih
qpenpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq

Timeline for d3omkc_:

• d3omkc_ is new in SCOPe 2.01-stable
  
• d3omkc_ appears in SCOPe 2.02
  
• d3omkc_ appears in the current release, SCOPe 2.08, called d3omkc1