Lineage for d3omfa_ (3omf A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929994Family d.13.1.0: automated matches [191614] (1 protein)
    not a true family
  6. 2929995Protein automated matches [191122] (10 species)
    not a true protein
  7. 2930004Species Entamoeba histolytica [TaxId:294381] [189454] (3 PDB entries)
  8. 2930007Domain d3omfa_: 3omf A: [183170]
    automated match to d1xqub_
    complexed with amp, zn

Details for d3omfa_

PDB Entry: 3omf (more details), 1.8 Å

PDB Description: crystal structure of a histidine triad family protein from entamoeba histolytica, bound to amp
PDB Compounds: (A:) Putative histidine triad family protein

SCOPe Domain Sequences for d3omfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3omfa_ d.13.1.0 (A:) automated matches {Entamoeba histolytica [TaxId: 294381]}
dscifckiaqkqipstivyeddeifafkdinpiapihilvipkqhiaslneiteeneafi
gkvlykvsligkkecpegyrvvnnigedagqtvkhihfhilggkklawdkl

SCOPe Domain Coordinates for d3omfa_:

Click to download the PDB-style file with coordinates for d3omfa_.
(The format of our PDB-style files is described here.)

Timeline for d3omfa_: