SCOPe 2.06: Domain d1abva_: 1abv A:

Lineage for d1abva_ (1abv A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.70: ATPD N-terminal domain-like [47927] (2 superfamilies)
   core: 5 helices; bundle

4. Superfamily a.70.1: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47928] (1 family)
   automatically mapped to Pfam PF00213

5. Family a.70.1.1: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47929] (1 protein)

6. Protein N-terminal domain of the delta subunit of the F1F0-ATP synthase [47930] (1 species)

7. Species Escherichia coli [TaxId:562] [47931] (2 PDB entries)

8. Domain d1abva_: 1abv A: [18317]

Details for d1abva_

PDB Entry: 1abv

PDB Description: n-terminal domain of the delta subunit of the f1f0-atp synthase from escherichia coli, nmr, minimized average structure

PDB Compounds: (A:) delta subunit of the f1f0-ATP synthase

SCOPe Domain Sequences for d1abva_:

Sequence; same for both SEQRES and ATOM records:

>d1abva_ a.70.1.1 (A:) N-terminal domain of the delta subunit of the F1F0-ATP synthase {Escherichia coli [TaxId: 562]}
sefitvarpyakaafdfavehqsverwqdmlafaaevtkneqmaellsgalapetlaesf
iavcgeqldengqnlirvmaengrlnalpdvleqfihlravseat

Timeline for d1abva_:

• d1abva_ first appeared (with stable ids) in SCOP 1.55, called d1abv__
  
• d1abva_ appears in SCOPe 2.05
  
• d1abva_ appears in SCOPe 2.07
  
• d1abva_ appears in the current release, SCOPe 2.08