![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.70: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47927] (1 superfamily) core: 5 helices; bundle |
![]() | Superfamily a.70.1: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47928] (1 family) ![]() |
![]() | Family a.70.1.1: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47929] (1 protein) |
![]() | Protein N-terminal domain of the delta subunit of the F1F0-ATP synthase [47930] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [47931] (2 PDB entries) |
![]() | Domain d1abva_: 1abv A: [18317] |
PDB Entry: 1abv (more details)
SCOP Domain Sequences for d1abva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1abva_ a.70.1.1 (A:) N-terminal domain of the delta subunit of the F1F0-ATP synthase {Escherichia coli [TaxId: 562]} sefitvarpyakaafdfavehqsverwqdmlafaaevtkneqmaellsgalapetlaesf iavcgeqldengqnlirvmaengrlnalpdvleqfihlravseat
Timeline for d1abva_: