Lineage for d1abv__ (1abv -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540250Fold a.70: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47927] (1 superfamily)
    core: 5 helices; bundle
  4. 540251Superfamily a.70.1: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47928] (1 family) (S)
  5. 540252Family a.70.1.1: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47929] (1 protein)
  6. 540253Protein N-terminal domain of the delta subunit of the F1F0-ATP synthase [47930] (1 species)
  7. 540254Species Escherichia coli [TaxId:562] [47931] (1 PDB entry)
  8. 540255Domain d1abv__: 1abv - [18317]

Details for d1abv__

PDB Entry: 1abv (more details)

PDB Description: n-terminal domain of the delta subunit of the f1f0-atp synthase from escherichia coli, nmr, minimized average structure

SCOP Domain Sequences for d1abv__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1abv__ a.70.1.1 (-) N-terminal domain of the delta subunit of the F1F0-ATP synthase {Escherichia coli}
sefitvarpyakaafdfavehqsverwqdmlafaaevtkneqmaellsgalapetlaesf
iavcgeqldengqnlirvmaengrlnalpdvleqfihlravseat

SCOP Domain Coordinates for d1abv__:

Click to download the PDB-style file with coordinates for d1abv__.
(The format of our PDB-style files is described here.)

Timeline for d1abv__: