SCOP 1.69: Domain d1abv__: 1abv -

Lineage for d1abv__ (1abv -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.70: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47927] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.70.1: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47928] (1 family)

5. Family a.70.1.1: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47929] (1 protein)

6. Protein N-terminal domain of the delta subunit of the F1F0-ATP synthase [47930] (1 species)

7. Species Escherichia coli [TaxId:562] [47931] (1 PDB entry)

8. Domain d1abv__: 1abv - [18317]

Details for d1abv__

PDB Entry: 1abv

PDB Description: n-terminal domain of the delta subunit of the f1f0-atp synthase from escherichia coli, nmr, minimized average structure

SCOP Domain Sequences for d1abv__:

Sequence; same for both SEQRES and ATOM records:

>d1abv__ a.70.1.1 (-) N-terminal domain of the delta subunit of the F1F0-ATP synthase {Escherichia coli}
sefitvarpyakaafdfavehqsverwqdmlafaaevtkneqmaellsgalapetlaesf
iavcgeqldengqnlirvmaengrlnalpdvleqfihlravseat

Timeline for d1abv__:

• d1abv__ first appeared (with stable ids) in SCOP 1.55
  
• d1abv__ appears in SCOP 1.67
  
• d1abv__ appears in SCOP 1.71
  
• d1abv__ appears in the current release, SCOPe 2.08, called d1abva_