![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.70: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47927] (1 superfamily) core: 5 helices; bundle |
![]() | Superfamily a.70.1: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47928] (1 family) ![]() |
![]() | Family a.70.1.1: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47929] (1 protein) |
![]() | Protein N-terminal domain of the delta subunit of the F1F0-ATP synthase [47930] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [47931] (1 PDB entry) |
![]() | Domain d1abv__: 1abv - [18317] |
PDB Entry: 1abv (more details)
SCOP Domain Sequences for d1abv__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1abv__ a.70.1.1 (-) N-terminal domain of the delta subunit of the F1F0-ATP synthase {Escherichia coli} sefitvarpyakaafdfavehqsverwqdmlafaaevtkneqmaellsgalapetlaesf iavcgeqldengqnlirvmaengrlnalpdvleqfihlravseat
Timeline for d1abv__: