Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) |
Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
Protein automated matches [190134] (3 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:272943] [189626] (4 PDB entries) |
Domain d3omaa_: 3oma A: [183168] Other proteins in same PDB: d3omab1, d3omab2, d3omab3, d3omad1, d3omad2, d3omad3 automated match to d1m56a_ complexed with ca, cd, cu, cu1, dmu, hea, hth, mg, oh, trd; mutant |
PDB Entry: 3oma (more details), 2.3 Å
SCOPe Domain Sequences for d3omaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3omaa_ f.24.1.1 (A:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]} ftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgf fqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafp rmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhl sgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltd rnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpm vyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgimifswiatmwggsie lktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagi yfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfv sslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtf
Timeline for d3omaa_: