Lineage for d3om8b_ (3om8 B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.0: automated matches [191404] (1 protein)
not a true familyProtein automated matches [190543] (71 species)
not a true protein
Species Pseudomonas aeruginosa [TaxId:208964] [189478] (7 PDB entries) 
Domain d3om8b_: 3om8 B: [183167]
automated match to d1va4a_
complexed with edo, mes
Details for d3om8b_
PDB Entry: 3om8 (more details), 2.25 Å
PDB Description: The crystal structure of a hydrolase from Pseudomonas aeruginosa PA01
PDB Compounds: (B:) Probable hydrolaseSCOPe Domain Sequences for d3om8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3om8b_ c.69.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
nagnlsflatsdgaslayrldgaaekpllalsnsigttlhmwdaqlpaltrhfrvlryda
rghgassvppgpytlarlgedvlelldalevrrahflglslggivgqwlalhapqrierl
vlantsawlgpaaqwderiaavlqaedmsetaagflgnwfppalleraepvverframlm
atnrhglagsfaavrdtdlraqlarierptlviagaydtvtaashgeliaasiagarlvt
lpavhlsnvefpqafegavlsflga
SCOPe Domain Coordinates for d3om8b_:
Click to download the PDB-style file with coordinates for d3om8b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3om8b_:
- d3om8b_ first appeared in SCOPe 2.01
- d3om8b_ appears in SCOPe 2.04
- d3om8b_ is called d3om8b1 in SCOPe 2.06
- d3om8b_ appears in the current release, SCOPe 2.08, called d3om8b1
View in 3D
