| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
| Protein automated matches [190543] (131 species) not a true protein |
| Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189478] (7 PDB entries) |
| Domain d3om8b1: 3om8 B:2-264 [183167] Other proteins in same PDB: d3om8a2, d3om8b2 automated match to d1va4a_ complexed with edo, mes |
PDB Entry: 3om8 (more details), 2.25 Å
SCOPe Domain Sequences for d3om8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3om8b1 c.69.1.0 (B:2-264) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
gnlsflatsdgaslayrldgaaekpllalsnsigttlhmwdaqlpaltrhfrvlrydarg
hgassvppgpytlarlgedvlelldalevrrahflglslggivgqwlalhapqrierlvl
antsawlgpaaqwderiaavlqaedmsetaagflgnwfppalleraepvverframlmat
nrhglagsfaavrdtdlraqlarierptlviagaydtvtaashgeliaasiagarlvtlp
avhlsnvefpqafegavlsflga
Timeline for d3om8b1: