SCOPe 2.08: Domain d3om8b1: 3om8 B:2-264

Lineage for d3om8b1 (3om8 B:2-264)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189478] (7 PDB entries)

8. Domain d3om8b1: 3om8 B:2-264 [183167]
   Other proteins in same PDB: d3om8a2, d3om8b2
   automated match to d1va4a_
   complexed with edo, mes

Details for d3om8b1

PDB Entry: 3om8, 2.25 Å

PDB Description: The crystal structure of a hydrolase from Pseudomonas aeruginosa PA01

PDB Compounds: (B:) Probable hydrolase

SCOPe Domain Sequences for d3om8b1:

Sequence; same for both SEQRES and ATOM records:

>d3om8b1 c.69.1.0 (B:2-264) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
gnlsflatsdgaslayrldgaaekpllalsnsigttlhmwdaqlpaltrhfrvlrydarg
hgassvppgpytlarlgedvlelldalevrrahflglslggivgqwlalhapqrierlvl
antsawlgpaaqwderiaavlqaedmsetaagflgnwfppalleraepvverframlmat
nrhglagsfaavrdtdlraqlarierptlviagaydtvtaashgeliaasiagarlvtlp
avhlsnvefpqafegavlsflga

Timeline for d3om8b1:

• d3om8b1 first appeared in SCOPe 2.01, called d3om8b_
  
• d3om8b1 appears in SCOPe 2.07