Lineage for d3om7b_ (3om7 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064801Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2064807Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2064867Family b.67.2.2: Levansucrase [101881] (1 protein)
    automatically mapped to Pfam PF02435
  6. 2064868Protein Levansucrase [101882] (2 species)
  7. 2064869Species Bacillus megaterium [TaxId:1404] [189676] (5 PDB entries)
  8. 2064876Domain d3om7b_: 3om7 B: [183163]
    automated match to d1oyga_
    complexed with ca, peg, pge, so4; mutant

Details for d3om7b_

PDB Entry: 3om7 (more details), 1.86 Å

PDB Description: Crystal structure of B. megaterium levansucrase mutant Y247W
PDB Compounds: (B:) Levansucrase

SCOPe Domain Sequences for d3om7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3om7b_ b.67.2.2 (B:) Levansucrase {Bacillus megaterium [TaxId: 1404]}
skdfnnsygishitrdnmvkipqqqnsdqfkvpafdestikniasakgknasgntidldv
wdswplqnadgtvatyhgyqivfalagdpkdsndtsvylfykkagdksidswknagrvfk
dsdkfvpndphlknqtqewsgsgtltkdgkvrlfytdysgkqygkqtlttaqvnmsqpnd
ntlkvdgvedyksifdgdgkiyqtvqqfideggwdtgdnhtlrdphyiednghkylvfea
ntgtedgyqgedslynrayyggnnpffqsekkkllegsnkekaslangalgiielnddyt
lkkvmkplitsntvtdeieranifkkdgkwylftdsrgskmtidgigqddvymlgyvsnt
ltgkykplndtglvlhmdldpndktftyshfavpqtkgdnvvitsymtnrgfyednhstf
apsflvnidgsktsvvkdrvleqgqltv

SCOPe Domain Coordinates for d3om7b_:

Click to download the PDB-style file with coordinates for d3om7b_.
(The format of our PDB-style files is described here.)

Timeline for d3om7b_: