Lineage for d3om5d_ (3om5 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807321Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2807331Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2807401Family b.67.2.2: Levansucrase [101881] (2 proteins)
    automatically mapped to Pfam PF02435
  6. 2807402Protein Levansucrase [101882] (2 species)
  7. 2807403Species Bacillus megaterium [TaxId:1404] [189676] (5 PDB entries)
  8. 2807416Domain d3om5d_: 3om5 D: [183157]
    automated match to d1oyga_
    complexed with ca, p6g, peg, pge, so4; mutant

Details for d3om5d_

PDB Entry: 3om5 (more details), 1.95 Å

PDB Description: Crystal structure of B. megaterium levansucrase mutant N252A
PDB Compounds: (D:) Levansucrase

SCOPe Domain Sequences for d3om5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3om5d_ b.67.2.2 (D:) Levansucrase {Bacillus megaterium [TaxId: 1404]}
skdfnnsygishitrdnmvkipqqqnsdqfkvpafdestikniasakgknasgntidldv
wdswplqnadgtvatyhgyqivfalagdpkdsndtsvylfykkagdksidswknagrvfk
dsdkfvpndphlknqtqewsgsgtltkdgkvrlfytdysgkqygkqtlttaqvnmsqpnd
ntlkvdgvedyksifdgdgkiyqtvqqfideggydtgdahtlrdphyiednghkylvfea
ntgtedgyqgedslynrayyggnnpffqsekkkllegsnkekaslangalgiielnddyt
lkkvmkplitsntvtdeieranifkkdgkwylftdsrgskmtidgigqddvymlgyvsnt
ltgkykplndtglvlhmdldpndktftyshfavpqtkgdnvvitsymtnrgfyednhstf
apsflvnidgsktsvvkdrvleqgqltv

SCOPe Domain Coordinates for d3om5d_:

Click to download the PDB-style file with coordinates for d3om5d_.
(The format of our PDB-style files is described here.)

Timeline for d3om5d_: