Lineage for d3om3c_ (3om3 C:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255095Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 2255096Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 2255097Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 2255189Protein automated matches [190134] (3 species)
    not a true protein
  7. 2255229Species Rhodobacter sphaeroides [TaxId:272943] [189626] (4 PDB entries)
  8. 2255237Domain d3om3c_: 3om3 C: [183149]
    Other proteins in same PDB: d3om3b1, d3om3b2, d3om3b3, d3om3d1, d3om3d2, d3om3d3
    automated match to d1m56a_
    complexed with ca, cd, cu1, dmu, hea, hth, mg, trd; mutant

Details for d3om3c_

PDB Entry: 3om3 (more details), 2.6 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with k362m mutation in the reduced state
PDB Compounds: (C:) Cytochrome c oxidase, aa3 type, subunit I

SCOPe Domain Sequences for d3om3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3om3c_ f.24.1.1 (C:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
wfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgffqs
lwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafprmn
nlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhlsga
ssilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltdrnf
gttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpmvya
mvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgimifswiatmwggsielkt
pmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagiyfw
igkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfvssl
gaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppeht

SCOPe Domain Coordinates for d3om3c_:

Click to download the PDB-style file with coordinates for d3om3c_.
(The format of our PDB-style files is described here.)

Timeline for d3om3c_: