Class b: All beta proteins [48724] (177 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (14 families) |
Family b.122.1.12: SRA domain-like [159368] (2 proteins) Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA |
Protein automated matches [191193] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189495] (3 PDB entries) |
Domain d3olnb_: 3oln B: [183144] automated match to d2zkda1 |
PDB Entry: 3oln (more details), 2.3 Å
SCOPe Domain Sequences for d3olnb_:
Sequence, based on SEQRES records: (download)
>d3olnb_ b.122.1.12 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivpsnhygpipgipvgstwrfrvqvseagvhrphvggihgrsndgayslvlaggfadevd rgdeftytgsggknlagnkrigapsadqtltnmnralalncdaplddkigaesrnwragk pvrvirsfkgrkiskyapeegnrydgiykvvkywpeissshgflvwryllrrddvepapw tsegiersrrlc
>d3olnb_ b.122.1.12 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivpsnhygpipgipvgstwrfrvqvseagvhrphvggihgrsndgayslvlaggfadevd rgdeftytgsggkngapsadqtltnmnralalncdaplddkigaesrnwragkpvrvirs fkgrkiskyapeegnrydgiykvvkywpeissshgflvwryllrrddvepapwtsegier srrlc
Timeline for d3olnb_: