Lineage for d3olna_ (3oln A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1813773Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 1813774Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 1813980Family b.122.1.12: SRA domain-like [159368] (2 proteins)
    Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA
  6. 1814007Protein automated matches [191193] (1 species)
    not a true protein
  7. 1814008Species Human (Homo sapiens) [TaxId:9606] [189495] (3 PDB entries)
  8. 1814013Domain d3olna_: 3oln A: [183143]
    automated match to d2zkda1

Details for d3olna_

PDB Entry: 3oln (more details), 2.3 Å

PDB Description: Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF2
PDB Compounds: (A:) E3 ubiquitin-protein ligase UHRF2

SCOPe Domain Sequences for d3olna_:

Sequence, based on SEQRES records: (download)

>d3olna_ b.122.1.12 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivpsnhygpipgipvgstwrfrvqvseagvhrphvggihgrsndgayslvlaggfadevd
rgdeftytgsggknlagnkrigapsadqtltnmnralalncdaplddkigaesrnwragk
pvrvirsfkgrkiskyapeegnrydgiykvvkywpeissshgflvwryllrrddvepapw
tsegiersrrlc

Sequence, based on observed residues (ATOM records): (download)

>d3olna_ b.122.1.12 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivpsnhygpipgipvgstwrfrvqvseagvhrphvggihgrsndgayslvlaggfadevd
rgdeftytgsggpsadqtltnmnralalncdaplddkigaesrnwragkpvrvirsfkgr
kiskyapeegnrydgiykvvkywpeissshgflvwryllrrddvepapwtsegiersrrl
c

SCOPe Domain Coordinates for d3olna_:

Click to download the PDB-style file with coordinates for d3olna_.
(The format of our PDB-style files is described here.)

Timeline for d3olna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3olnb_