SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3olna_ (3oln A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2076966Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2076967Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 2077175Family b.122.1.12: SRA domain-like [159368] (2 protein domains)
    Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA
  6. 2077202Protein automated matches [191193] (1 species)
    not a true protein
  7. 2077203Species Human (Homo sapiens) [TaxId:9606] [189495] (3 PDB entries)
  8. 2077208Domain d3olna_: 3oln A: [183143]
    automated match to d2zkda1

Details for d3olna_

PDB Entry: 3oln (more details), 2.3 Å

PDB Description: Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF2
PDB Compounds: (A:) E3 ubiquitin-protein ligase UHRF2

SCOPe Domain Sequences for d3olna_:

Sequence, based on SEQRES records: (download)

>d3olna_ b.122.1.12 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivpsnhygpipgipvgstwrfrvqvseagvhrphvggihgrsndgayslvlaggfadevd
rgdeftytgsggknlagnkrigapsadqtltnmnralalncdaplddkigaesrnwragk
pvrvirsfkgrkiskyapeegnrydgiykvvkywpeissshgflvwryllrrddvepapw
tsegiersrrlc

Sequence, based on observed residues (ATOM records): (download)

>d3olna_ b.122.1.12 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivpsnhygpipgipvgstwrfrvqvseagvhrphvggihgrsndgayslvlaggfadevd
rgdeftytgsggpsadqtltnmnralalncdaplddkigaesrnwragkpvrvirsfkgr
kiskyapeegnrydgiykvvkywpeissshgflvwryllrrddvepapwtsegiersrrl
c

SCOPe Domain Coordinates for d3olna_:

Click to download the PDB-style file with coordinates for d3olna_.
(The format of our PDB-style files is described here.)

Timeline for d3olna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3olnb_