![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein automated matches [190118] (10 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189675] (2 PDB entries) |
![]() | Domain d3olmd_: 3olm D: [183142] automated match to d1otrb_ |
PDB Entry: 3olm (more details), 2.5 Å
SCOPe Domain Sequences for d3olmd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3olmd_ d.15.1.1 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlr
Timeline for d3olmd_: